PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g42350.1.p
Common NameBRADI_3g42350, LOC100840448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 229aa    MW: 25803.7 Da    PI: 10.6801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g42350.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.8e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                      +g+WT eEd++l   v+ +G g+W++ +r  g  +R++k+c++rw +yl
  Bradi3g42350.1.p 14 KGAWTREEDDRLSSHVRAHGEGRWRALPRLAGlPHRCGKSCRLRWVNYL 62
                      79*********************************************97 PP

2Myb_DNA-binding51.22.9e-1668113148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++ +Ed l+v +++ lG++ W+ Ia++++ gRt++++k++w+++l
  Bradi3g42350.1.p  68 RGAFSRDEDALIVALHAALGNR-WAMIAAKLP-GRTDNEIKNYWNTHL 113
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-23565IPR009057Homeodomain-like
PROSITE profilePS5129413.896962IPR017930Myb domain
SuperFamilySSF466892.0E-2713109IPR009057Homeodomain-like
SMARTSM007173.4E-121364IPR001005SANT/Myb domain
PfamPF002499.0E-141462IPR001005SANT/Myb domain
CDDcd001675.61E-101662No hitNo description
PROSITE profilePS5129425.93163117IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-2566117IPR009057Homeodomain-like
SMARTSM007174.2E-1567115IPR001005SANT/Myb domain
PfamPF002495.9E-1468113IPR001005SANT/Myb domain
CDDcd001675.17E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MGRSPCCEKA HTTKGAWTRE EDDRLSSHVR AHGEGRWRAL PRLAGLPHRC GKSCRLRWVN  60
YLRPDLKRGA FSRDEDALIV ALHAALGNRW AMIAAKLPGR TDNEIKNYWN THLGRRLKGM  120
GIDPVTHRPV VAAAAAGVWD GDGDAAVSFV RTQMPERKKA PPRCPDLNLE LRISPPWQEE  180
EEMPQRAPVK RDVKPAKREE TQQLKPLQGG DFLGLRAGML DFRRIQMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281311726128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574896.11e-168PREDICTED: myb-related protein Zm38-like
SwissprotP200251e-84MYB38_MAIZE; Myb-related protein Zm38
TrEMBLI1I9A41e-168I1I9A4_BRADI; Uncharacterized protein
STRINGBRADI3G42350.11e-167(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-80myb domain protein 7